PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.D00040.1.p
Common NameEUGRSUZ_D00040, LOC104440628
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 257aa    MW: 29403.8 Da    PI: 6.7783
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.D00040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.42.2e-151865148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+W++eEd++lv ++k++G  +W+  a+  g+ Rt+k+c++rw +yl
  Eucgr.D00040.1.p 18 KGAWSAEEDQKLVAYIKRYGIWNWAHMAKPAGLARTGKSCRLRWMNYL 65
                      79******************99************************97 PP

2Myb_DNA-binding48.81.6e-1572114246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       g+ T+eE+e ++ +++ lG++ W++Ia++++ gRt++++k++w++
  Eucgr.D00040.1.p  72 GNITKEEEETIIVLHRVLGNR-WAAIAARLP-GRTDNEIKNYWNT 114
                       678******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.0041365IPR017930Myb domain
SuperFamilySSF466894.12E-2916112IPR009057Homeodomain-like
SMARTSM007173.4E-111767IPR001005SANT/Myb domain
PfamPF002492.2E-131865IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-231972IPR009057Homeodomain-like
CDDcd001671.41E-92065No hitNo description
PROSITE profilePS5129423.96166120IPR017930Myb domain
SMARTSM007175.7E-1570118IPR001005SANT/Myb domain
PfamPF002493.9E-1472114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-2573120IPR009057Homeodomain-like
CDDcd001671.68E-1075116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MARYPRNDKS NNKTAVKKGA WSAEEDQKLV AYIKRYGIWN WAHMAKPAGL ARTGKSCRLR  60
WMNYLRPNIK HGNITKEEEE TIIVLHRVLG NRWAAIAARL PGRTDNEIKN YWNTRLRKRV  120
SEEFSLQNTR NDVDLHTDGK DISFHPLNDS PKATNLGLDY QIPTTNADNS CPSVGVHDEK  180
PWSYARCALE EYENGEGESL WKQVLAVEDF YIEEDFKRMC ANSGTNNAPS YGCTQPEPTY  240
FASCYDDFVL DLWGES*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29181207108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.D00040.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010051856.10.0PREDICTED: myb-related protein 308-like
TrEMBLA0A059CBW50.0A0A059CBW5_EUCGR; Uncharacterized protein
STRINGPOPTR_0019s14140.12e-53(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28110.13e-50myb domain protein 41